General Information

  • ID:  hor000676
  • Uniprot ID:  P01261(87-118)
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Ovis aries (Sheep)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLSAYWKDLNNYHRYSGMGFGPETP
  • Length:  32(87-118)
  • Propeptide:  MGFGKSSPFLAFSILVLCQAGSLQATPLRSALETLPDPGALSEKEGRLLLAALVKAYVQRKTNELEQEEEQEETEDSSLDSSRAKRCSNLSTCVLSAYWKDLNNYHRYSGMGFGPETPGKKRDIANSLEKDLSSHFGVPTDAN
  • Signal peptide:  MGFGKSSPFLAFSILVLCQAGSLQA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood
  • Mechanism:  Promot the incorporation of those ions in the bones.
  • Cross BBB:  NA
  • Target:  RAMP1, CALCR
  • Target Unid:  W5QCE6, W5NRE5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-P01261-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000676_AF2.pdbhor000676_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 416513 Formula: C159H232N42O49S3
Absent amino acids: IQ Common amino acids: S
pI: 7.25 Basic residues: 3
Polar residues: 17 Hydrophobic residues: 7
Hydrophobicity: -49.38 Boman Index: -4609
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 1102.19 Extinction Coefficient cystines: 10095
Absorbance 280nm: 325.65

Literature

  • PubMed ID:  NA
  • Title:  Accelerated procedures for automated peptide degradation.